SEC62 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SEC62 Recombinant monoclonal antibody (87925-1-RR)

• 

  WB analysis using 87925-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87925-1-RR (SEC62 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 87925-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SEC62 antibody (87925-1-RR, Clone: 253590D1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

SEC62 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87925-1-RR

Clone No.253590D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Translocation protein SEC62, hTP-1, SEC 62, TP-1, Translocation protein 1

---

Tested Applications

• Positive WB detected in: LoVo cells, SW480 cells, SKOV-3 cells, SK-BR-3 cells, NIH/3T3 cells, C6 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87925-1-RR targets SEC62 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29932

  Product name: Recombinant human SEC62 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of NM_003262

  Sequence: MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNE

• Full Name: SEC62 homolog (S. cerevisiae)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_003262
• Gene Symbol: SEC62
• Gene ID (NCBI): 7095
• RRID: AB_3745830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99442
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEC62 is an integral endoplasmic reticulum (ER) membrane protein. SEC62 and SEC63 form a dimeric complex and play a central role in the translocation of nascent and newly synthesized precursor polypeptides into the ER. SEC62 is associated with poor prognosis in a variety of tumors, such as prostate cancer, hepatocellular cancer, breast cancer, melanoma, and colorectal cancer (PMID: 36262254).