SECISBP2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86488-1-RR (same clone as 86488-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86488-1-RR (SECISBP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86488-1-PBS in a different storage buffer formulation.

SECISBP2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86488-1-PBS

Clone No.251311A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

SBP2, SECIS binding protein 2, SECIS-binding protein 2, Selenocysteine insertion sequence-binding protein 2

---

Product Information

86488-1-PBS targets SECISBP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3541

  Product name: Recombinant human SECISBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 506-854 aa of BC036109

  Sequence: NPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKERQERKQRLQENAVGPAFTSDDTQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL

• Full Name: SECIS binding protein 2
• Calculated Molecular Weight: 854 aa, 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC036109
• Gene Symbol: SECISBP2
• Gene ID (NCBI): 79048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96T21
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SECISBP2 (also called SECIS-binding protein 2 or SBP2) is an RNA-binding protein that serves as the master regulator of selenoprotein synthesis in eukaryotes. It recognizes and binds the SECIS (SEC Insertion Sequence) stem-loop structure located in the 3′-UTR of all selenoprotein mRNAs, thereby converting the otherwise stop-coding UGA triplet into the 21st amino acid selenocysteine (Sec) during translation.