SEL1L3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEL1L3 Polyclonal antibody, PBS Only (31489-1-PBS)

• 

  WB analysis using 31489-1-AP (same clone as 31489-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31489-1-AP (SEL1L3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31489-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Daudi using 31489-1-AP (same clone as 31489-1-PBS)

  IP result of anti-SEL1L3 (IP:31489-1-AP, 4ug; Detection:31489-1-AP 1:1000) with Daudi cells lysate 1600 ug. This data was developed using the same antibody clone with 31489-1-PBS in a different storage buffer formulation.

• 

  IP experiment of U-251 using 31489-1-AP (same clone as 31489-1-PBS)

  IP result of anti-SEL1L3 (IP:31489-1-AP, 4ug; Detection:31489-1-AP 1:1000) with U-251 cells lysate 1320 ug. This data was developed using the same antibody clone with 31489-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 31489-1-AP (same clone as 31489-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 31489-1-AP (SEL1L3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31489-1-PBS in a different storage buffer formulation.

SEL1L3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 31489-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

KIAA0746, Protein sel 1 homolog 3, Sel 1L3

---

Product Information

31489-1-PBS targets SEL1L3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34856

  Product name: Recombinant human SEL1L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-236 aa of BC060867

  Sequence: KYSGRDWNVKWEENLLHAVAKNYTLLQTIPPFERPFKDHQVCLEWNMGYIWNLRANRIPQCPLENDVVALLGFPYASSGENTGIVKKFPRFRNRELEATRRQRMDYPVFTVSLWLYLLHYCKANLCGILYFVDSNEMYGTPSVFLTEEGYLHIQMHLVKGEDLAVKTKFIIPLKEWFRLDISFNGGQIVVTTSIGQDLKSYHNQTISFRE

• Full Name: KIAA0746 protein
• Observed Molecular Weight: 129 kDa
• GenBank Accession Number: BC060867
• Gene Symbol: KIAA0746
• Gene ID (NCBI): 23231
• RRID: AB_3742437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q68CR1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SEL1L3 is also named suppressor of lin-12-like protein 3. SEL1L3, a protein with multiple glycosylation sites, was identified as the BCR target in 3/20 PVRL cases. SEL1L3 induces proliferation and BCR pathway activation in aggressive lymphoma cell lines. Moreover, SEL1L3 conjugated to a toxin killed exclusively lymphoma cells with respective BCR-reactivity (PMID: 38671086).