SELENBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SELENBP1 Polyclonal antibody (27230-1-AP)

SELENBP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27230-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

56 kDa selenium-binding protein, EC:1.8.3.4, hSBP, hSP56, LPSB

• 

  WB analysis using 27230-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27230-1-AP (SELENBP1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27230-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27230-1-AP (SELENBP1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 27230-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27230-1-AP (SELENBP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27230-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27230-1-AP (SELENBP1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27230-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27230-1-AP (SELENBP1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27230-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27230-1-AP (SELENBP1 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27230-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27230-1-AP (SELENBP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27230-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27230-1-AP (SELENBP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 27230-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using SELENBP1 antibody (27230-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SELENBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, mouse liver tissue, MCF-7 cells, SK-BR-3 cells, T-47D cells, rat liver tissue
• Positive IHC detected in: human liver tissue, human colon tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27230-1-AP targets SELENBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20967

  Product name: Recombinant human SELENBP1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-305 aa of BC009084

  Sequence: MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKDELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKGWLLPE

• Full Name: selenium binding protein 1
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC009084
• Gene Symbol: SELENBP1
• Gene ID (NCBI): 8991
• RRID: AB_2880811
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13228
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SELENBP1 (selenium binding protein 1,SBP1), also known as LPSB or SP56, is a 472 amino acid peripheral membrane protein that binds selenium covalently. Selenium, an essential trace element, has been shown to have an anti-cancer effect. Many reports have described a relationship between insufficient selenium intake and increased risk of cancer. Moreover, the expression of SELENBP1 has been shown to be decreased in several tumors including cancers of the prostate, lungs, colon, and ovary (PMID: 21143902, 20332323, 18272210). SELENBP1 has four isoforms with the molecular mass of 56kD, 52kD and 45kD.

Publications

What published studies show

The SELENBP1 Polyclonal antibody (catalog number 27230-1-AP) has 4 total citations. These appear in four journals: Science China Life Sciences, Human Reproduction, BMC Gastroenterology, and Reproductive Sciences. The associated research fields span kidney fibrosis in chronic kidney disease, chemotherapy-induced ovarian damage, immunotherapy efficacy in colorectal cancer, and male infertility/teratozoospermia. Applications cited include immunofluorescence and Western blot in human and mouse samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Sci China Life Sci; SELENBP1 protects against kidney fibrosis in chronic kidney disease as a methanethiol oxidase; Authors - Yue Zhang
human	WB	Hum Reprod; Proteomic profiling reveals the molecular signatures of chemotherapy-induced human ovarian damage.; Authors - Johanne Grosboi
human	WB	BMC Gastroenterol; Tumor microenvironment-related gene selenium-binding protein 1 (SELENBP1) is associated with immunotherapy efficacy and survival in colorectal cancer; Authors - Cheng Zhu
mouse	IF	Reprod Sci; Unraveling the Impact of the PROCA1 Mutation in Male Infertility: Incorporating Whole Exome Sequencing in Teratozoospermia Patients and Analyzing Proca1 Knockout Mice; Authors - Na Zheng