Product Information
12561-1-PBS targets SELK in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3143 Product name: Recombinant human SELK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC013162 Sequence: MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG Predict reactive species |
| Full Name | selenoprotein K |
| Calculated Molecular Weight | 94 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC013162 |
| Gene Symbol | SELK |
| Gene ID (NCBI) | 58515 |
| RRID | AB_2186964 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6D0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Selenoprotein K (SelK), a single-pass transmembrane protein that resides in the endoplasmic reticulum (ER) membrane, which has been reported to an emerging role of playing a part in protein palmitoylation. Human SelK is a 94-amino-acid protein with Sec residing at the penultimate position. It has been shown that SelK is expressed predominantly in the heart and skeletal muscle, but other tissues, such as the liver, pancreas, and placenta, also have detectable levels of SelK.(PMID: 36252341)
