SELS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SELS Polyclonal antibody (15591-1-AP)

• Featured Product
• KD/KO Validated

SELS Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 15591-1-AP Copied!

Publications (37)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

AD 015, ADO15, SBBI8, Selenoprotein S, SELENOS

• 

  WB analysis of rat brain using 15591-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15591-1-AP (SELS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15591-1-AP

  WB result of SELS antibody (15591-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SELS transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15591-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15591-1-AP (SELS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 15591-1-AP

  IP result of anti-SELS (IP:15591-1-AP, 3ug; Detection:15591-1-AP 1:500) with HepG2 cells lysate 600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 15591-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 15591-1-AP (SELS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 15591-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 15591-1-AP (SELS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 15591-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SELS antibody (15591-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SELS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat brain tissue, HeLa cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15591-1-AP targets SELS in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7928

  Product name: Recombinant human SELS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC005840

  Sequence: MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

• Full Name: selenoprotein S
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005840
• Gene Symbol: SELS
• Gene ID (NCBI): 55829
• RRID: AB_2263813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQE4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SELS, also named as VIMP and SEPS1, plays an important role in the production of inflammatory cytokines and its expression is activated by endoplasmic reticulum (ER) stress. It probably acts by serving as a linker between DERL1 and VCP.

Publications

What published studies show

SELS (Selenoprotein S) polyclonal antibody (Cat# 15591-1-AP) has 37 citations published in journals including Molecular Cell, Science Advances, Antioxidants, Journal of Animal Science and Biotechnology, International Immunopharmacology, and Biological Trace Element Research. Research fields span ferroptosis, cancer (HCC, RCC, thyroid), endoplasmic reticulum stress, heat stress, selenium metabolism, Alzheimer's disease, inflammation, osteogenic differentiation, cartilage damage, lipid metabolism, and oxidative stress.

Automatically generated from the 37 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Mol Cell; Hypoxia-driven lncRNA SHIELD promotes GPX4 translation and protects against ferroptosis in hepatocellular carcinoma.; Authors - Kejia Liu
human	WB	Sci Adv; Oncoprotein SND1 hijacks nascent MHC-I heavy chain to ER-associated degradation, leading to impaired CD8+ T cell response in tumor.; Authors - Yuan Wang
chicken	WB	Anim Nutr; Selenomethionine alleviates chronic heat stress-induced breast muscle injury and poor meat quality in broilers via relieving mitochondrial dysfunction and endoplasmic reticulum stress; Authors - Jinzhong Jing
mouse	WB	Antioxidants (Basel); Selenoprotein K Is Essential for the Migration and Phagocytosis of Immature Dendritic Cells; Authors - Huan Xia
pig	WB	Antioxidants (Basel); Hydroxy Selenomethionine Improves Meat Quality through Optimal Skeletal Metabolism and Functions of Selenoproteins of Pigs under Chronic Heat Stress.; Authors - Yan Liu
mouse	WB	Antioxidants (Basel); Reversal of Lipid Metabolism Dysregulation by Selenium and Folic Acid Co-Supplementation to Mitigate Pathology in Alzheimer's Disease.; Authors - Zhong-Hao Zhang