CoraLite®594-conjugated SELS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite®594-conjugated SELS Polyclonal antibody (CL594-15591)

• Featured Product
• KD/KO Validated

SELS Polyclonal Antibody for IF-P

Cat No. CL594-15591

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

AD 015, ADO15, SBBI8, Selenoprotein S, SELENOS

• 

  IF Staining of mouse brain using CL594-15591

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite®594 SELS antibody (CL594-15591) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-15591 targets SELS in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7928

  Product name: Recombinant human SELS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC005840

  Sequence: MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

• Full Name: selenoprotein S
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005840
• Gene Symbol: SELS
• Gene ID (NCBI): 55829
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQE4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SELS, also named as VIMP and SEPS1, plays an important role in the production of inflammatory cytokines and its expression is activated by endoplasmic reticulum (ER) stress. It probably acts by serving as a linker between DERL1 and VCP.