Product Information
33518-1-PBS targets SELT in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38727 Product name: Recombinant human SELT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-195 aa of BC008411 Sequence: FGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS Predict reactive species |
| Full Name | selenoprotein T |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC008411 |
| Gene Symbol | SELT |
| Gene ID (NCBI) | 51714 |
| RRID | AB_3742999 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P62341 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

