SELT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SELT Polyclonal antibody, PBS Only (33518-1-PBS)

• 

  WB analysis using 33518-1-AP (same clone as 33518-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33518-1-AP (SELT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33518-1-PBS in a different storage buffer formulation.

SELT Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33518-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:1.8.1.9, SELENOT, Thioredoxin reductase-like selenoprotein T, UNQ150/PRO176

---

Product Information

33518-1-PBS targets SELT in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38727

  Product name: Recombinant human SELT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-195 aa of BC008411

  Sequence: FGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS

• Full Name: selenoprotein T
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC008411
• Gene Symbol: SELT
• Gene ID (NCBI): 51714
• RRID: AB_3742999
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P62341
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.