SEMA4F Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEMA4F Polyclonal antibody, PBS Only (12474-1-PBS)

• 

  WB analysis of mouse lung using 12474-1-AP (same clone as 12474-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12474-1-AP (SEMA4F antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 12474-1-AP (same clone as 12474-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12474-1-AP (SEMA4F antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 12474-1-AP (same clone as 12474-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12474-1-AP (SEMA4F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12474-1-AP (same clone as 12474-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12474-1-AP (SEMA4F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12474-1-AP (same clone as 12474-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12474-1-AP (SEMA4F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 12474-1-AP (same clone as 12474-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 12474-1-AP (SEMA4F antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 12474-1-AP (same clone as 12474-1-PBS)

  IP result of anti-SEMA4F (IP:12474-1-AP, 4ug; Detection:12474-1-AP 1:500) with HepG2 cells lysate 3600ug. This data was developed using the same antibody clone with 12474-1-PBS in a different storage buffer formulation.

SEMA4F Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 12474-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

12474-1-PBS targets SEMA4F in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3082

  Product name: Recombinant human SEMA4F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 272-615 aa of BC018361

  Sequence: LVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAAHVVAAYSLVWGSQRDAPSRAHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI

• Full Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
• Calculated Molecular Weight: 615 aa, 66 kDa
• Observed Molecular Weight: 66 kDa, 84 kDa
• GenBank Accession Number: BC018361
• Gene Symbol: SEMA4F
• Gene ID (NCBI): 10505
• RRID: AB_2185847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95754
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.