SEMG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEMG2 Polyclonal antibody, PBS Only (31203-1-PBS)

• 

  IHC staining of mouse testis using 31203-1-AP (same clone as 31203-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31203-1-AP (SEMG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31203-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 31203-1-AP (same clone as 31203-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31203-1-AP (SEMG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31203-1-PBS in a different storage buffer formulation.

SEMG2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 31203-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Semenogelin 2, semenogelin II, Semenogelin-2, SGII

---

Product Information

31203-1-PBS targets SEMG2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35285

  Product name: Recombinant human SEMG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 490-582 aa of NM_003008.2

  Sequence: SQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSHEQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST

• Full Name: semenogelin II
• Calculated Molecular Weight: 65kDa，582aa
• GenBank Accession Number: NM_003008.2
• Gene Symbol: SEMG2
• Gene ID (NCBI): 6407
• RRID: AB_3742408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q02383
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SEMG2 genes belong to the family of cancer-testis antigens (CTAs), whose expression normally is restricted to male germ cells but is often restored in various malignancies. SEMGs were found expressed in various malignancies including prostate, lung, and renal carcinoma, as well as in some blood neoplasms (PMID: 33311447).