Home
Products
Primary Antibodies
SEPX1 Polyclonal antibody, PBS Only (15333-1-PBS)

Filter: AllIHC

IHC staining of mouse kidney using 15333-1-AP (same clone as 15333-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney using 15333-1-AP (SEPX1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15333-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 15333-1-AP (same clone as 15333-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney using 15333-1-AP (SEPX1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15333-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 15333-1-AP (same clone as 15333-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney using 15333-1-AP (SEPX1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15333-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 15333-1-AP (same clone as 15333-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney using 15333-1-AP (SEPX1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15333-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 15333-1-AP (same clone as 15333-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney using 15333-1-AP (SEPX1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15333-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 15333-1-AP (same clone as 15333-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney using 15333-1-AP (SEPX1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15333-1-PBS in a different storage buffer formulation.

SEPX1 Polyclonal antibody, PBS Only

Name: SEPX1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 15333-1-PBS

SEPX1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15333-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

15333-1-PBS targets SEPX1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7391 Product name: Recombinant human SEPX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC003127 Sequence: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQG Predict reactive species
Full Name	selenoprotein X, 1
Calculated Molecular Weight	13 kDa
GenBank Accession Number	BC003127
Gene Symbol	SEPX1
Gene ID (NCBI)	51734
RRID	AB_2878127
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NZV6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.