Product Information
15333-1-PBS targets SEPX1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7391 Product name: Recombinant human SEPX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC003127 Sequence: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQG Predict reactive species |
| Full Name | selenoprotein X, 1 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC003127 |
| Gene Symbol | SEPX1 |
| Gene ID (NCBI) | 51734 |
| RRID | AB_2878127 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZV6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |











