Serpin A4/Kallistatin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Serpin A4/Kallistatin Polyclonal antibody (11430-2-AP)

Serpin A4/Kallistatin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11430-2-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Kallistatin, Serpin A4, KAL, Kallikrein inhibitor, KLST

• 

  WB analysis of human spleen using 11430-2-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 11430-2-AP (Kallistatin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human plasma using 11430-2-AP

  human serum were subjected to SDS PAGE followed by western blot with 11430-2-AP (Kallistatin antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11430-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11430-2-AP (Kallistatin antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HCT 116 using 11430-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HCT 116 cells using Kallistatin antibody (11430-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Serpin A4/Kallistatin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human spleen tissue, human plasma tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11430-2-AP targets Serpin A4/Kallistatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1962

  Product name: Recombinant human SERPINA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-427 aa of BC014992

  Sequence: QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

• Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC014992
• Gene Symbol: Kallistatin
• Gene ID (NCBI): 5267
• RRID: AB_2185735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29622
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kallistatin is also named Serpin A4 and Peptidase inhibitor 4 (PI-4). Kallistatin was first identified in human plasma as a tissue kallikrein-binding protein and a serine proteinase inhibitor. Kallistatin via its two structural elements regulates differential signaling cascades, and thus a wide spectrum of biological functions (PMID: 28427524). Kallistatin via the active site promotes neovascularization by stimulating VEGF levels in endothelial progenitor cells. Second, kallistatin inhibits or induces apoptosis depending on cell types. Kallistatin via its heparin-binding site inhibits angiogenesis by blocking vascular endothelial growth factor (VEGF)-induced growth, migration and adhesion of endothelial cells. Kallistatin can act as an antioxidant or pro-oxidant (PMID: 28742513).

Publications

What published studies show

The Serpin A4/Kallistatin Polyclonal antibody (Cat# 11430-2-AP) has 1 total citation. It was cited in the journal Diabetes (Impact Factor 9.3), in a study investigating the pathogenic role of diabetes-induced Kallistatin overexpression in corneal wound healing deficiency through inhibition of canonical Wnt signaling. The research field encompasses diabetes, corneal wound healing, and Wnt signaling pathway regulation. The antibody was applied in WB and IF in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Diabetes; Pathogenic Role of Diabetes-induced Overexpression of Kallistatin in Corneal Wound Healing Deficiency through Inhibition of Canonical Wnt Signaling.; Authors - Wentao Liang