Serpin A4/Kallistatin Polyclonal antibody

• 

  WB analysis of human spleen using 11430-2-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 11430-2-AP (Kallistatin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 11430-2-AP

  human serum were subjected to SDS PAGE followed by western blot with 11430-2-AP (Kallistatin antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 11430-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11430-2-AP (Kallistatin antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HCT 116 using 11430-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HCT 116 cells using Kallistatin antibody (11430-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

Serpin A4/Kallistatin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11430-2-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Kallistatin, Serpin A4, KAL, Kallikrein inhibitor, KLST

---

Tested Applications

• Positive WB detected in: human spleen tissue, human plasma tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

11430-2-AP targets Serpin A4/Kallistatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1962

  Product name: Recombinant human SERPINA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-427 aa of BC014992

  Sequence: QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

• Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC014992
• Gene Symbol: Kallistatin
• Gene ID (NCBI): 5267
• RRID: AB_2185735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29622
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kallistatin is also named Serpin A4 and Peptidase inhibitor 4 (PI-4). Kallistatin was first identified in human plasma as a tissue kallikrein-binding protein and a serine proteinase inhibitor. Kallistatin via its two structural elements regulates differential signaling cascades, and thus a wide spectrum of biological functions (PMID: 28427524). Kallistatin via the active site promotes neovascularization by stimulating VEGF levels in endothelial progenitor cells. Second, kallistatin inhibits or induces apoptosis depending on cell types. Kallistatin via its heparin-binding site inhibits angiogenesis by blocking vascular endothelial growth factor (VEGF)-induced growth, migration and adhesion of endothelial cells. Kallistatin can act as an antioxidant or pro-oxidant (PMID: 28742513).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Diabetes; Pathogenic Role of Diabetes-induced Overexpression of Kallistatin in Corneal Wound Healing Deficiency through Inhibition of Canonical Wnt Signaling.; Authors - Wentao Liang