SERPINB7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SERPINB7 Polyclonal antibody, PBS Only (21170-1-PBS)

• 

  WB analysis using 21170-1-AP (same clone as 21170-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21170-1-AP (SERPINB7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21170-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21170-1-AP (same clone as 21170-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21170-1-AP (SERPINB7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21170-1-PBS in a different storage buffer formulation.

SERPINB7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21170-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Serpin B7, MEGSIN, TP55

---

Product Information

21170-1-PBS targets SERPINB7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15394

  Product name: Recombinant human SERPINB7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-305 aa of BC069417

  Sequence: SLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKA

• Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 7
• Calculated Molecular Weight: 380 aa, 43 kDa
• Observed Molecular Weight: 43-45 kDa
• GenBank Accession Number: BC069417
• Gene Symbol: SERPINB7
• Gene ID (NCBI): 8710
• RRID: AB_3742020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75635
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Serine protease inhibitor B7 (SERPINB7) is also named Serpin B7, Megsin and TP55. SerpinB7 is identified as a skin-specific endogenous protease inhibitor. SerpinB7 is upregulated in diabetic nephropathy and induces progressive mesangial expansion (PMID: 11877466). SERPINB7 is abundantly expressed in keratinocytes, with particularly high levels in the stratum corneum and stratum granulosum of the epidermis (PMID: 41469525). SERPINB7 promotes keratinocyte differentiation and dampens inflammation in psoriasis in a calcium-dependent manner (PMID: 35864103). SERPINB7 is expressed mostly in renal mesangial cells, and its expression is significantly increased in renal tissues of IgA and diabetic nephropathies. SERPINB7 regulates cell proliferation, signal transduction, and extracellular matrix metabolism (PMID: 37809412).