SERPINB9 Monoclonal antibody

• 

  WB analysis of K-562 using 67950-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Daudi using 67950-1-Ig

  Daudi cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 67950-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Ramos using 67950-1-Ig

  Ramos cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 67950-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 67950-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67950-1-Ig (SERPINB9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 67950-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67950-1-Ig (SERPINB9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of C6 using 67950-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed C6 cells using SERPINB9 antibody (67950-1-Ig, Clone: 2H9D2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

SERPINB9 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67950-1-Ig

Clone No.2H9D2

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CAP 3, CAP3, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI 9, PI9, Serpin B9, SERPINB9

---

Tested Applications

• Positive WB detected in: K-562 cells, human placenta tissue, Daudi cells, Raji cells, Ramos cells
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67950-1-Ig targets SERPINB9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6719

  Product name: Recombinant human SERPINB9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-376 aa of BC002538

  Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

• Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 9
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC002538
• Gene Symbol: SERPINB9
• Gene ID (NCBI): 5272
• RRID: AB_2918702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P50453
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINB9, also named as PI-9, belongs to the serpin family. SERPINB9 is an intracellular inhibitor of granzyme B (grB) that protects cytotoxic lymphocytes from grB-mediated death. It has a nucleo-cytoplasmic distribution and is produced in CD8+ T cells and natural killer cells (PMID: 28024184). Also, SERPINB9 is expressed by vascular SMCs and endothelial cells to avoid GZB-induced apoptosis (PMID: 28743062). The molecular weight of SERPINB9 is 42 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Immunotherapy; The development of anti-PD-1 antibody-induced spinal cord injury in bone marrow transplant C57BL/6 Rag1-/- mouse model; Authors - Huachun Chen
human	IHC,IF	Cell Death Dis; Single-cell landscape identified SERPINB9 as a key player contributing to stemness and metastasis in non-seminomas; Authors - Zhouliang Bian ; KD Validated