SERPINB9 Monoclonal antibody, PBS Only

• 

  WB analysis of K-562 using 67950-1-Ig (same clone as 67950-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 67950-1-Ig (same clone as 67950-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 67950-1-Ig (same clone as 67950-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 67950-1-Ig (same clone as 67950-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67950-1-Ig (same clone as 67950-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67950-1-Ig (SERPINB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 67950-1-Ig (same clone as 67950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67950-1-Ig (SERPINB9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 67950-1-Ig (same clone as 67950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67950-1-Ig (SERPINB9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C6 using 67950-1-Ig (same clone as 67950-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed C6 cells using SERPINB9 antibody (67950-1-Ig, Clone: 2H9D2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67950-1-PBS in a different storage buffer formulation.

SERPINB9 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67950-1-PBS

Clone No.2H9D2

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CAP 3, CAP3, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI 9, PI9, Serpin B9, SERPINB9

---

Product Information

67950-1-PBS targets SERPINB9 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6719

  Product name: Recombinant human SERPINB9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-376 aa of BC002538

  Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

• Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 9
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC002538
• Gene Symbol: SERPINB9
• Gene ID (NCBI): 5272
• RRID: AB_2918702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P50453
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SERPINB9, also named as PI-9, belongs to the serpin family. SERPINB9 is an intracellular inhibitor of granzyme B (grB) that protects cytotoxic lymphocytes from grB-mediated death. It has a nucleo-cytoplasmic distribution and is produced in CD8+ T cells and natural killer cells (PMID: 28024184). Also, SERPINB9 is expressed by vascular SMCs and endothelial cells to avoid GZB-induced apoptosis (PMID: 28743062). The molecular weight of SERPINB9 is 42 kDa.