SETD5 Recombinant monoclonal antibody

• 

  WB analysis using 84622-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84622-4-RR (SETD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SETD5 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84622-4-RR

Clone No.241903D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA1757, Histone-lysine N-methyltransferase SETD5, 241903D4

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, HEK-293T cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84622-4-RR targets SETD5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28929

  Product name: Recombinant human SETD5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-202 aa of BC020956

  Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE

• Full Name: SET domain containing 5
• Observed Molecular Weight: 160-220 kDa
• GenBank Accession Number: BC020956
• Gene Symbol: SETD5
• Gene ID (NCBI): 55209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9C0A6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494).