SETD5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84622-4-RR (same clone as 84622-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84622-4-RR (SETD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84622-4-PBS in a different storage buffer formulation.

SETD5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84622-4-PBS

Clone No.241903D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

KIAA1757, Histone-lysine N-methyltransferase SETD5, 241903D4

---

Product Information

84622-4-PBS targets SETD5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28929

  Product name: Recombinant human SETD5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-202 aa of BC020956

  Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE

• Full Name: SET domain containing 5
• Observed Molecular Weight: 160-220 kDa
• GenBank Accession Number: BC020956
• Gene Symbol: SETD5
• Gene ID (NCBI): 55209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9C0A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494).