SEZ6L2 Polyclonal antibody

• 

  WB analysis using 19428-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19428-1-AP (SEZ6L2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SEZ6L2 Polyclonal Antibody for WB, ELISA

Cat No. 19428-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PSK, PSK 1, Seizure 6 like protein 2, SEZ6L2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19428-1-AP targets SEZ6L2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13760

  Product name: Recombinant human SEZ6L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 280-626 aa of BC000567

  Sequence: RVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLE

• Full Name: seizure related 6 homolog (mouse)-like 2
• Calculated Molecular Weight: 910 aa, 98 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC000567
• Gene Symbol: SEZ6L2
• Gene ID (NCBI): 26470
• RRID: AB_3085577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXD5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Seizure 6-like protein 2 (SEZ6L2) is a type 1 transmembrane protein predominantly expressed in the brain. It belongs to the seizure-related gene 6 (SEZ6) family, which contains SEZ6, SEZ6L and SEZ6L2. SEZ6 family members have been shown to influence synapse numbers and dendritic morphology and are linked to various neurological and psychiatric disorders (PMID: 33936031). SEZ6L2 is a part of the AMPA receptor and acts as a scaffolding protein to link GluR1 to adducin (PMID: 29032200). Overexpression of SEZ6L2 has been reported in a variety of cancers, including lung cancer, hepatocellular carcinoma, thyroid carcinoma, cholangiocarcinoma (PMID: 16863507; 35117286; 35284305; 32148567). SEZ6L2 can be glycosylated and the apparent molecular weight can be raised to 150-170 kDa (PMID: 26698217; 24272587).