SEZ6L2 Polyclonal antibody

SEZ6L2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 19428-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

PSK, Seizure 6 like protein 2, Seizure 6-like protein 2, UNQ1903/PRO4349

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19428-1-AP targets SEZ6L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13760

Product name: Recombinant human SEZ6L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 280-626 aa of BC000567

Sequence: RVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLE

Predict reactive species
Full Name seizure related 6 homolog (mouse)-like 2
Calculated Molecular Weight 910 aa, 98 kDa
Observed Molecular Weight150 kDa
GenBank Accession NumberBC000567
Gene Symbol SEZ6L2
Gene ID (NCBI) 26470
RRIDAB_3085577
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6UXD5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Seizure 6-like protein 2 (SEZ6L2) is a type 1 transmembrane protein predominantly expressed in the brain. It belongs to the seizure-related gene 6 (SEZ6) family, which contains SEZ6, SEZ6L and SEZ6L2. SEZ6 family members have been shown to influence synapse numbers and dendritic morphology and are linked to various neurological and psychiatric disorders (PMID: 33936031). SEZ6L2 is a part of the AMPA receptor and acts as a scaffolding protein to link GluR1 to adducin (PMID: 29032200). Overexpression of SEZ6L2 has been reported in a variety of cancers, including lung cancer, hepatocellular carcinoma, thyroid carcinoma, cholangiocarcinoma (PMID: 16863507; 35117286; 35284305; 32148567). SEZ6L2 can be glycosylated and the apparent molecular weight can be raised to 150-170 kDa (PMID: 26698217; 24272587).

Protocols

Product Specific Protocols
IHC protocol for SEZ6L2 antibody 19428-1-APDownload protocol
WB protocol for SEZ6L2 antibody 19428-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...