SF3A2 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 15596-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15596-1-AP (SF3A2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15596-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15596-1-AP (SF3A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15596-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15596-1-AP (SF3A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human endometrial cancer using 15596-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 15596-1-AP (SF3A2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human endometrial cancer using 15596-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 15596-1-AP (SF3A2 antibody) at dilution of 1:50 (under 10x lens).

SF3A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15596-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

PRP11, PRPF11, SAP 62, SAP62, SF3A2, SF3a66, Splicing factor 3A subunit 2

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, HeLa cells
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

15596-1-AP targets SF3A2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7953

  Product name: Recombinant human SF3A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-464 aa of BC004434

  Sequence: KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

• Full Name: splicing factor 3a, subunit 2, 66kDa
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC004434
• Gene Symbol: SF3A2
• Gene ID (NCBI): 8175
• RRID: AB_2301609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15428
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	J Biol Chem; Identification of a 35S U4/U6.U5 Tri-snRNP Complex Intermediate in Spliceosome Assembly.; Authors - Zhe Chen
rat	WB,IF,CoIP	J Adv Res; Ginsenoside Rb2 inhibits p300-mediated SF3A2 acetylation at lysine 10 to promote Fscn1 alternative splicing against myocardial ischemic/reperfusion injury; Authors - Qingxia Huang
mouse	WB	iScience; Adipocyte-specific Steap4 deficiency reduced thermogenesis and energy expenditure in mice; Authors - Han Wang