SF3A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SF3A2 Polyclonal antibody, PBS Only (15596-1-PBS)

• 

  WB analysis of NIH/3T3 using 15596-1-AP (same clone as 15596-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15596-1-AP (SF3A2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15596-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15596-1-AP (same clone as 15596-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15596-1-AP (SF3A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15596-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15596-1-AP (same clone as 15596-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15596-1-AP (SF3A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15596-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 15596-1-AP (same clone as 15596-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 15596-1-AP (SF3A2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15596-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 15596-1-AP (same clone as 15596-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 15596-1-AP (SF3A2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15596-1-PBS in a different storage buffer formulation.

SF3A2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15596-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15596-1-PBS targets SF3A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7953

  Product name: Recombinant human SF3A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-464 aa of BC004434

  Sequence: KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

• Full Name: splicing factor 3a, subunit 2, 66kDa
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC004434
• Gene Symbol: SF3A2
• Gene ID (NCBI): 8175
• RRID: AB_2301609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15428
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.