SF3B3 Monoclonal antibody, PBS Only

SF3B3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 67469-1-PBS
Clone No.2H7F5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

SAP130, SAP 130, RSE1, Pre-mRNA-splicing factor SF3b 130 kDa subunit, KIAA0017

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67469-1-PBS targets SF3B3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6315

Product name: Recombinant human SF3B3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 250-399 aa of BC003146

Sequence: EDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Predict reactive species
Full Name splicing factor 3b, subunit 3, 130kDa
Calculated Molecular Weight 136 kDa
Observed Molecular Weight 130-135 kDa
GenBank Accession NumberBC003146
Gene Symbol SF3B3
Gene ID (NCBI) 23450
RRIDAB_2882698
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15393
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Introns are removed from nuclear pre-mRNA in 2-step transesterification reactions. Splicing occured in a large ribonucleoprotein particle, called the spliceosome. Spliceosomal intermediate complexes form on pre-mRNA in the order E, A, B, and C, with the catalytic reactions occurring in complex C. U2 small nuclear ribonucleoproteins are one of the proteins essential for spliceosome assembly and mRNA splicing. Functional U2 snRNP is composed of a 12S unit and 2 splicing factors, SF3A, which is composed of 3 proteins, and SF3B, which conposed of 4 proteins. SF3B3 is one of SF3B, and it's required for 'A' complex assembly formed by the stable binding of U2 snRNP to the brachpoint sequence(BPS) in pre-mRNA.

Loading...
||
New chat Able
正在加载,请稍候...