SF3B4 Recombinant monoclonal antibody, PBS Only

SF3B4 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85663-5-PBS
Clone No.243098D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49, SF3b49, SF3b50

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85663-5-PBS targets SF3B4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0737

Product name: Recombinant human SF3B4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC004273

Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP

Predict reactive species
Full Name splicing factor 3b, subunit 4, 49kDa
Calculated Molecular Weight 44 aa, 3 kDa
Observed Molecular Weight49 kDa
GenBank Accession NumberBC004273
Gene Symbol SF3B4
Gene ID (NCBI) 10262
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15427
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SF3B4, also named as Pre-mRNA-splicing factor SF3b 49 kDa subunit, is a 424 amino acid protein, which belongs to the SF3B4 family. SF3B4 is a subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. The calculated molecular weight of SF3B4 is 44 kDa. Based on its predicted molecular mass and the observed migration of the 50kDa cross-linked species on two-dimensional gels.(PMID: 9614130)

Loading...
||
New chat Able
正在加载,请稍候...