SF3B4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85663-5-RR (same clone as 85663-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85663-5-RR (SF3B4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85663-5-PBS in a different storage buffer formulation.

SF3B4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85663-5-PBS

Clone No.243098D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49, SF3b49, SF3b50

---

Product Information

85663-5-PBS targets SF3B4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0737

  Product name: Recombinant human SF3B4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC004273

  Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP

• Full Name: splicing factor 3b, subunit 4, 49kDa
• Calculated Molecular Weight: 44 aa, 3 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC004273
• Gene Symbol: SF3B4
• Gene ID (NCBI): 10262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15427
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SF3B4, also named as Pre-mRNA-splicing factor SF3b 49 kDa subunit, is a 424 amino acid protein, which belongs to the SF3B4 family. SF3B4 is a subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. The calculated molecular weight of SF3B4 is 44 kDa. Based on its predicted molecular mass and the observed migration of the 50kDa cross-linked species on two-dimensional gels.(PMID: 9614130)