SF4 Monoclonal antibody

• 

  WB analysis using 68319-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68319-1-Ig (SF4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  WB analysis of NCCIT using 68319-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 68319-1-Ig (SF4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of A549 using 68319-1-Ig

  1x10^6 A549 cells were intracellularly stained with 0.4 ug SF4 Monoclonal antibody (68319-1-Ig, Clone:1G9D8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG2a isotype control Mouse McAb (66360-2-Ig, Clone: 11A1B2) (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

SF4 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 68319-1-Ig

Clone No.1G9D8

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

SURP and G-patch domain-containing protein 1, SUGP1, Splicing factor 4, RNA-binding protein RBP, F23858

---

Tested Applications

• Positive WB detected in: U2OS cells, NCCIT cells, A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, MOLT-4 cells, K-562 cells
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68319-1-Ig targets SF4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8014

  Product name: Recombinant human SF4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-348 aa of BC002986

  Sequence: LYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY

• Full Name: splicing factor 4
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 55 kDa, 72 kDa
• GenBank Accession Number: BC002986
• Gene Symbol: SF4
• Gene ID (NCBI): 57794
• RRID: AB_3085055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWZ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.