SF4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68319-1-Ig (same clone as 68319-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68319-1-Ig (SF4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68319-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 68319-1-Ig (same clone as 68319-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 68319-1-Ig (SF4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68319-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 68319-1-Ig (same clone as 68319-1-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.4 ug SF4 Monoclonal antibody (68319-1-Ig, Clone:1G9D8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG2a isotype control Mouse McAb (66360-2-Ig, Clone: 11A1B2) (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 68319-1-PBS in a different storage buffer formulation.

SF4 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 68319-1-PBS

Clone No.1G9D8

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

SURP and G-patch domain-containing protein 1, SUGP1, Splicing factor 4, RNA-binding protein RBP, F23858

---

Product Information

68319-1-PBS targets SF4 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8014

  Product name: Recombinant human SF4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-348 aa of BC002986

  Sequence: LYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY

• Full Name: splicing factor 4
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 55 kDa, 72 kDa
• GenBank Accession Number: BC002986
• Gene Symbol: SF4
• Gene ID (NCBI): 57794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWZ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.