14-3-3 Sigma Polyclonal antibody

14-3-3 Sigma Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10622-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

SFN, HME1, 14-3-3sigma, 14-3-3 protein sigma

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, A549 cells, HeLa cells, U2OS cells
Positive IHC detected inmouse skin tissue, human bowen disease
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10622-1-AP targets 14-3-3 Sigma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0973

Product name: Recombinant human SFN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-248 aa of BC002995

Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Predict reactive species
Full Name stratifin
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28-30 kDa
GenBank Accession NumberBC002995
Gene Symbol 14-3-3 Sigma
Gene ID (NCBI) 2810
RRIDAB_2254479
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31947
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

14-3-3 Sigma is a member 14-3-3 family of highly conserved proteins participating in diverse cellular processes including cell cycle progression. It is exclusively present in various epithelial cells, and alternatively named as human epithelial marker (HEM), or stratifin. Alteration of its expression has been linked to cancer.

Protocols

Product Specific Protocols
IHC protocol for 14-3-3 Sigma antibody 10622-1-APDownload protocol
WB protocol for 14-3-3 Sigma antibody 10622-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Sci Rep

Sting and p53 DNA repair pathways are compromised in Alzheimer's disease

Authors - Thomas J Nelson
humanWB

Phytomedicine

Acetylation of MOB1 mediates polyphyllin II-reduced lysosome biogenesis in breast cancer by promoting the cytoplasmic retention of the YAP/TFEB coactivator complex

Authors - Yuliang Ren
human,mouseWB,IHC

J Proteome Res

Quantitative Proteomics Reveal the Mechanism of MiR-138-5p Suppressing Cervical Cancer via Targeting ZNF385A

Authors - Qihang Peng
Loading...
||
New chat Able
正在加载,请稍候...