• Featured Product
  • KD/KO Validated

SFPQ Monoclonal antibody

SFPQ Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 67129-1-Ig
Clone No.1G4A5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

100 kDa DNA-pairing protein, 1G4A5, DNA-binding p52/p100 complex, 100 kDa subunit, Polypyrimidine tract-binding protein-associated-splicing factor, POMP 100

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-251 cells, HSC-T6 cells, HeLa cells, Jurkat cells, PC-3 cells, HEK-293 cells, NIH/3T3 cells, A431 cells, LNCaP cells, K-562 cells
Positive IHC detected inrat stomach tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue, mouse brain tissue, mouse stomach tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, MCF-7 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67129-1-Ig targets SFPQ in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7181

Product name: Recombinant human SFPQ protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC051192

Sequence: MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSTPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPRRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF

Predict reactive species
Full Name splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
Calculated Molecular Weight 76 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC051192
Gene Symbol SFPQ
Gene ID (NCBI) 6421
RRIDAB_2882428
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP23246
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFPQ, also named PSF, encodes a nuclear factor implicated in the splicing and regulation of gene expression. SFPQ probably forms a heteromer with NONO and participates in DNA pairing and DNA break repair program. Very recently SFPQ was identified as a downstream target of tau, complete nuclear depletion and cytoplasmic accumulation of SFPQ were shown in the neurons and astrocytes of brains with Alzheimer's disease (AD), more strikingly, reduced SFPQ levels may progress together with tau pathology, these observation strongly suggests the important role of SFPQ pathology in neurodegenerative diseases including AD. SFPQ encompasses 707 amino acids and has a molecular weight of 76 kDa, although it typically migrates on a sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) gel at an apparent molecular weight of ∼100 kDa. Proteolytic cleavage products of apparent molecular weights of 47 and 68 kDa, and an alternatively spliced form of 669 amino acids, have also been described in various cell types. (PMID: 25832716). Splicing Factor Proline and Glutamine rich (SFPQ) as the most significant intron-retaining transcript across diverse ALS-causing mutations (VCP, SOD1 and FUS). SFPQ protein binds extensively to its retained intron, which exhibits high cytoplasmic abundance in VCP mutation compared with controls. Crucially, the protein is less abundant in the nuclei of VCP mutation cultures and is ultimately lost from nuclei of MNs in mouse models (SOD1mu and VCP mutation transgenic mouse models) and human sporadic ALS post-mortem samples. In summary, our study implicates SFPQ IR and nuclear loss as general molecular hallmarks of familial and sporadic ALS.

Protocols

Product Specific Protocols
WB protocol for SFPQ antibody 67129-1-IgDownload protocol
IHC protocol for SFPQ antibody 67129-1-IgDownload protocol
IF protocol for SFPQ antibody 67129-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Mol Sci

SFPQ and Its Isoform as Potential Biomarker for Non-Small-Cell Lung Cancer

Authors - Libang Yang
mouse,humanWB

Int J Mol Sci

Serum Splicing Factor Proline- and Glutamine-Rich Is a Diagnostic Marker for Non-Small-Cell Lung Cancer and Other Solid Cancers

Authors - Libang Yang
humanWB,IF

Nat Commun

Virus-modified paraspeckle-like condensates are hubs for viral RNA processing and their formation drives genomic instability

Authors - Katherine L Harper
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ruth (Verified Customer) (11-12-2024)

Good staining resulting in nice clear images but titration to lower concentrations resulted in rapid loss of signal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: UT7/TPO WT and JAK2V617F, SET2 and HEL cell lines
Loading...
||
New chat Able
正在加载,请稍候...