Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SFPQ Monoclonal antibody

SFPQ Monoclonal Antibody for FC (Intra)

Cat No. CL488-67129
Clone No.1G4A5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

FC (Intra)

POMP100, POMP 100, Polypyrimidine tract-binding protein-associated-splicing factor, DNA-binding p52/p100 complex, 100 kDa subunit, 1G4A5

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67129 targets SFPQ in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7181

Product name: Recombinant human SFPQ protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC051192

Sequence: MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSTPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPRRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF

Predict reactive species
Full Name splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
Calculated Molecular Weight 76 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC051192
Gene Symbol SFPQ
Gene ID (NCBI) 6421
RRIDAB_3084310
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP23246
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SFPQ, also named PSF, encodes a nuclear factor implicated in the splicing and regulation of gene expression. SFPQ probably forms a heteromer with NONO and participates in DNA pairing and DNA break repair program. Very recently SFPQ was identified as a downstream target of tau, complete nuclear depletion and cytoplasmic accumulation of SFPQ were shown in the neurons and astrocytes of brains with Alzheimer's disease (AD), more strikingly, reduced SFPQ levels may progress together with tau pathology, these observation strongly suggests the important role of SFPQ pathology in neurodegenerative diseases including AD. SFPQ encompasses 707 amino acids and has a molecular weight of 76 kDa, although it typically migrates on a sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) gel at an apparent molecular weight of ∼100 kDa. Proteolytic cleavage products of apparent molecular weights of 47 and 68 kDa, and an alternatively spliced form of 669 amino acids, have also been described in various cell types. (PMID: 25832716). Splicing Factor Proline and Glutamine rich (SFPQ) as the most significant intron-retaining transcript across diverse ALS-causing mutations (VCP, SOD1 and FUS). SFPQ protein binds extensively to its retained intron, which exhibits high cytoplasmic abundance in VCP mutation compared with controls. Crucially, the protein is less abundant in the nuclei of VCP mutation cultures and is ultimately lost from nuclei of MNs in mouse models (SOD1mu and VCP mutation transgenic mouse models) and human sporadic ALS post-mortem samples. In summary, our study implicates SFPQ IR and nuclear loss as general molecular hallmarks of familial and sporadic ALS.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SFPQ antibody CL488-67129Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...