Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SFRP1 Polyclonal antibody

SFRP1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-Fro, ELISA

Cat No. 26460-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-Fro, ELISA

FRP1, FRP-1, SARP2, SARP-2, Secreted apoptosis-related protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue, SH-SY5Y cells, U2OS cells, mouse testis tissue
Positive IHC detected inhuman breast cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26460-1-AP targets SFRP1 in WB, IHC, IF/ICC, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24844

Product name: Recombinant human SFRP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 164-250 aa of BC036503

Sequence: DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYL

Predict reactive species
Full Name secreted frizzled-related protein 1
Calculated Molecular Weight 314 aa, 35 kDa
Observed Molecular Weight 30-35 kDa
GenBank Accession NumberBC036503
Gene Symbol SFRP1
Gene ID (NCBI) 6422
RRIDAB_2880522
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N474
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFRP1 (Secreted Frizzled-Related Protein 1) is a secreted glycoprotein that functions as a key modulator of the Wnt signaling pathway. The SFRP1 protein harbors two independent structural domains, namely the carboxy-terminal netrin (NTR) domain and an amino-terminal cysteine-rich domain (CRD). Secreted SFRP1 is an inhibitor of the Wnt signalling pathway and has been classified as a tumor suppressor gene due to the loss of its expression in many human cancers (PMID: 32074995). SFRP1 is necessary for stress-induced senescence caused by these factors and is sufficient for the induction of senescence phenotypes.

Protocols

Product Specific Protocols
IF protocol for SFRP1 antibody 26460-1-APDownload protocol
IHC protocol for SFRP1 antibody 26460-1-APDownload protocol
WB protocol for SFRP1 antibody 26460-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Genes Dis

Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice

Authors - Liying Shan
humanWB

APL Bioeng

Oscillatory shear stress-induced downregulation of TET1s injures vascular endothelial planar cell polarity by suppression of actin polymerization

Authors - Kai Qu
  • KD Validated
humanWB

Aging (Albany NY)

Exosome-mediated Hic-5 regulates proliferation and apoptosis of osteosarcoma via Wnt/β-catenin signal pathway.

Authors - Liansheng Sha
humanIHC

Transl Oncol

Excavating regulated cell death signatures to predict prognosis, tumor microenvironment and therapeutic response in HR+/HER2- breast cancer

Authors - Shuangshuang Mao
ratIHC

Cells

Secreted Frizzled-Related Protein 1 Promotes Odontoblastic Differentiation and Reparative Dentin Formation in Dental Pulp Cells.

Authors - Keita Ipposhi

Cell Rep

Demyelination Regulates the Circadian Transcription Factor BMAL1 to Signal Adult Neural Stem Cells to Initiate Oligodendrogenesis.

Authors - Suihong Huang

Reviews

    2.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (03-14-2023)

There are doubts about if this antibody is working in WB. There are some non-specific bands and the supposed band is very weak.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HepG2, mouse liver, mouse kidney, mouse brain
SFRP1 Antibody Western Blot validation (1:2000 dilution) in HepG2, mouse liver, mouse kidney, mouse brain (Cat no:26460-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...