Tested Applications
| Positive WB detected in | A549 cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue, SH-SY5Y cells, U2OS cells, mouse testis tissue |
| Positive IHC detected in | human breast cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26460-1-AP targets SFRP1 in WB, IHC, IF/ICC, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24844 Product name: Recombinant human SFRP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 164-250 aa of BC036503 Sequence: DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYL Predict reactive species |
| Full Name | secreted frizzled-related protein 1 |
| Calculated Molecular Weight | 314 aa, 35 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC036503 |
| Gene Symbol | SFRP1 |
| Gene ID (NCBI) | 6422 |
| RRID | AB_2880522 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N474 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFRP1 (Secreted Frizzled-Related Protein 1) is a secreted glycoprotein that functions as a key modulator of the Wnt signaling pathway. The SFRP1 protein harbors two independent structural domains, namely the carboxy-terminal netrin (NTR) domain and an amino-terminal cysteine-rich domain (CRD). Secreted SFRP1 is an inhibitor of the Wnt signalling pathway and has been classified as a tumor suppressor gene due to the loss of its expression in many human cancers (PMID: 32074995). SFRP1 is necessary for stress-induced senescence caused by these factors and is sufficient for the induction of senescence phenotypes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SFRP1 antibody 26460-1-AP | Download protocol |
| IHC protocol for SFRP1 antibody 26460-1-AP | Download protocol |
| WB protocol for SFRP1 antibody 26460-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SFRP1 Polyclonal antibody (catalog number 26460-1-AP) has 19 citations. Journals include Nature Communications, Genes & Diseases, Cell Reports in Medicine, Journal of Orthopaedic Translation, Journal of Translational Medicine, International Journal of Molecular Medicine, Molecular Medicine, Cell Reports, EMBO Reports, Cells, Aging, International Journal of Molecular Sciences, APL Bioengineering, Stem Cell Reviews & Reports, Translational Oncology, Cell Signaling, Regenerative Therapy, Biochemical and Biophysical Research Communications, and In Vitro Cell & Developmental Biology. Research fields span bone biology (osteoporosis, osteoblast differentiation), dentinogenesis, Wnt/β-catenin signaling, neuroinflammation, preeclampsia, hair follicle regeneration, fibrosis, and cancer.
| Species | Application | Title |
|---|---|---|
Nat Commun Spatiotemporal interplay between epithelial and mesenchymal cells drives human dentinogenesis. | ||
Genes Dis Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice | ||
Cell Rep Med Schwann cell-secreted frizzled-related protein 1 dictates neuroinflammation and peripheral nerve degeneration after neurotrauma | ||
J Orthop Translat Silencing SFRP1 in bone mesenchymal stem cells alleviates pediatric B-ALL-driven bone loss by activating Wnt/β-catenin signaling. | ||
J Transl Med USP22 suppresses trophoblast cell necroptosis in preeclampsia by stabilizing KAT2A-mediated histone acetylation at the SFRP1 promoter. | ||
Int J Mol Med METTL3 inhibits LINC00312 to suppress osteoporosis progression in a YTHDF2‑dependent manner. |
Reviews
What customers say
The single review for this antibody reports a Western Blot application at a 1:2000 dilution across HepG2 cells and mouse liver, kidney, and brain tissues. The reviewer expressed doubt about the antibody's performance in WB, noting the presence of non-specific bands and that the expected target band appeared very weak. Overall, the feedback was negative, reflecting concerns about specificity and signal strength in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (03-14-2023) | There are doubts about if this antibody is working in WB. There are some non-specific bands and the supposed band is very weak.
 |
