SFRS11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SFRS11 Polyclonal antibody, PBS Only (26751-1-PBS)

• 

  WB analysis of HEK-293T using 26751-1-AP (same clone as 26751-1-PBS)

  WB result of SFRS11 antibody (26751-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SFRS11 transfected HEK-293T cells. This data was developed using the same antibody clone with 26751-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26751-1-AP (same clone as 26751-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26751-1-AP (SFRS11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 26751-1-AP (same clone as 26751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26751-1-AP (SFRS11 antibody) at dilution of 1:1000 (under 10x lens). This data was developed using the same antibody clone with 26751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 26751-1-AP (same clone as 26751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26751-1-AP (SFRS11 antibody) at dilution of 1:1000 (under 40x lens). This data was developed using the same antibody clone with 26751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 26751-1-AP (same clone as 26751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 26751-1-AP (SFRS11 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 26751-1-AP (same clone as 26751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 26751-1-AP (SFRS11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26751-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SFRS11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26751-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Arginine-rich 54 kDa nuclear protein, p54, Serine/arginine-rich splicing factor 11, Splicing factor, arginine/serine-rich 11, SRSF11

---

Product Information

26751-1-PBS targets SFRS11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25015

  Product name: Recombinant human SFRS11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 398-483 aa of BC040436

  Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD

• Full Name: splicing factor, arginine/serine-rich 11
• Calculated Molecular Weight: 483 aa, 53 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC040436
• Gene Symbol: SFRS11
• Gene ID (NCBI): 9295
• RRID: AB_3085902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05519
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.