SFXN3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85978-1-RR (same clone as 85978-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85978-1-RR (SFXN3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85978-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C6 using 85978-1-RR (same clone as 85978-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed C6 cells using SFXN3 antibody (85978-1-RR, Clone: 250485B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85978-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85978-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85978-1-RR against Human SFXN3 were performed. The affinity constant is below 1 pM.

SFXN3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85978-1-PBS

Clone No.250485B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

SFX3, sideroflexin 3, Sideroflexin-3

---

Product Information

85978-1-PBS targets SFXN3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7203

  Product name: Recombinant human SFXN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC000124

  Sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP

• Full Name: sideroflexin 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000124
• Gene Symbol: SFXN3
• Gene ID (NCBI): 81855
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BWM7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SFXN3, a mitochondrial membrane protein, is a member of sideroflexin family. Serum anti-SFXN3 autoantibody was elevated in early stage of the oral squamous cell carcinoma significantly, indicating its clinical value for diagnosis of oral squamous cell carcinoma.