Alpha Sarcoglycan Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 13222-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13222-1-AP (Alpha-sarcoglycan antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

Alpha sarcoglycan Polyclonal Antibody for WB, ELISA

Cat No. 13222-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

50 DAG, 50DAG, A2, adhalin, ADL, Alpha sarcoglycan, Alpha SG, DAG2, DMDA2, Dystroglycan 2, LGMD2D, SCARMD1, SGCA

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13222-1-AP targets Alpha sarcoglycan in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3924

  Product name: Recombinant human SGCA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-289 aa of BC025702

  Sequence: QTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD

• Full Name: sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
• Calculated Molecular Weight: 387 aa, 43 kDa
• GenBank Accession Number: BC025702
• Gene Symbol: alpha Sarcoglycan
• Gene ID (NCBI): 6442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16586
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-sarcoglycan is a member of the sarcoglycan-sarcospan complex (SG-SSPN), which is constituted by α/ɛ-, β-, γ-, and δ-SGs as well as SSPN. Alpha-sarcoglycan gene expression is exclusive of striated muscle and is finely regulated during myogenic differentiation, where the amount of alpha-sarcoglycan transcript is selectively increased after differentiation to myotubes (MTs). Alpha sarcoglycan's disruption causes limb-girdle muscular dystrophy.