Product Information
24327-1-PBS targets SGLT3/SLC5A4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19391 Product name: Recombinant human SLC5A4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 579-633 aa of BC153069 Sequence: SQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSER Predict reactive species |
| Full Name | solute carrier family 5 (low affinity glucose cotransporter), member 4 |
| Calculated Molecular Weight | 659 aa, 72 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC153069 |
| Gene Symbol | SGLT3 |
| Gene ID (NCBI) | 6527 |
| RRID | AB_2650519 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NY91 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC5A4, also known as SGLT3, is a sugar sensor that depolarizes the plasma membrane in response to external glucose (PMID: 12748858, 20421923). SGLT3 mediates the influx of sodium ions into the cell but does not transport sugars, also potently activated by imino sugars such as deoxynojirimycin (PMID: 22766068, 13130073). SGLT3 is a plasma membrane protein, shares 70% identity with SGLT1, and is expressed in the small intestine (cholinergic neurons), skeletal muscle, kidney, uterus, and testis (PMID: 12748858). SGLT3 protein at apparent molecular masses of 72 kDa and 80 kDa in human kidney tissue and HK-2 cells (PMID: 22766068).
