SGMS1 Polyclonal antibody

• 

  WB analysis of human heart using 19050-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 19050-1-AP (SGMS1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 19050-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19050-1-AP (SGMS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 19050-1-AP

  IP result of anti-SGMS1 (IP:19050-1-AP, 4ug; Detection:19050-1-AP 1:300) with mouse heart tissue lysate 4000ug.

• 

  IHC staining of human liver using 19050-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 19050-1-AP (SGMS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 19050-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 19050-1-AP (SGMS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SGMS1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 19050-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EC:2.7.8.27, hmob33, Medulla oblongata-derived protein, MOB, MOB1

---

Tested Applications

• Positive WB detected in: HT-29 cells, human heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 9 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

19050-1-AP targets SGMS1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5246

  Product name: Recombinant human SGMS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-145 aa of BC042899

  Sequence: MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGKTFLAFLYALSC

• Full Name: sphingomyelin synthase 1
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 25 kDa, 49 kDa
• GenBank Accession Number: BC042899
• Gene Symbol: SGMS1
• Gene ID (NCBI): 259230
• RRID: AB_2188417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VZ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sphingomyelin synthase (SMS), with two isoforms, SMS1 (SGMS1) and SMS2, is a key enzyme involved in the generation and development of SM. SMS can participate in inflammation, atherosclerosis, proliferation, apoptosis, differentiation and other functions(PMID:30535436). SMS1 is frequently downregulated in various solid cancers, more particularly in melanoma(PMID:31114500). SGMS1 has two isoforms.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cancer Res; Aneuploid cell survival relies upon sphingolipid homeostasis.; Authors - Yun-Chi Tang ; KD Validated
human	IHC	J Clin Endocrinol Metab; Dysregulated sphingolipid metabolism in endometriosis.; Authors - Yie Hou Lee
mouse	WB,IHC	FASEB J; Sphingomyelin maintains the cutaneous barrier via regulation of the STAT3 pathway.; Authors - Mariko Komuro
mouse,human	WB,IF	Exp Neurol; Inhibition of sphingomyelin synthase 1 ameliorates alzheimer-like pathology in APP/PS1 transgenic mice through promoting lysosomal degradation of BACE1.; Authors - Mei-Hong Lu ; KD Validated
mouse	WB	iScience; The Symbiotic Relationship between the Neural Retina and Retinal Pigment Epithelium Is Supported by Utilizing Differential Metabolic Pathways.; Authors - Tirthankar Sinha
mouse	IF	Drug Des Devel Ther; Involvement of Huanglian Jiedu Decoction on Microglia with Abnormal Sphingolipid Metabolism in Alzheimer's Disease.; Authors - Yi-Yu Qi