SH2B1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SH2B1 Polyclonal antibody, PBS Only (12226-1-PBS)

• 

  WB analysis using 12226-1-AP (same clone as 12226-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12226-1-AP (SH2B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12226-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 12226-1-AP (same clone as 12226-1-PBS)

  IP result of anti-SH2B1 (IP:12226-1-AP, 4ug; Detection:12226-1-AP 1:1500) with HepG2 cells lysate 1080 ug. This data was developed using the same antibody clone with 12226-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 12226-1-AP (same clone as 12226-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 12226-1-AP (SH2B1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12226-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 12226-1-AP (same clone as 12226-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 12226-1-AP (SH2B1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12226-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 12226-1-AP (same clone as 12226-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 12226-1-AP (SH2B1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12226-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12226-1-AP (same clone as 12226-1-PBS)

  Immunofluorescent analysis of HeLa cells using 12226-1-AP (SH2B1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12226-1-PBS in a different storage buffer formulation.

SH2B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12226-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

KIAA1299, Pro-rich, PH and SH2 domain-containing signaling mediator, PSM, SH2 B, SH2 domain-containing protein 1B

---

Product Information

12226-1-PBS targets SH2B1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2863

  Product name: Recombinant human SH2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC010704

  Sequence: MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQ

• Full Name: SH2B adaptor protein 1
• Calculated Molecular Weight: 426 aa, 45 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC010704
• Gene Symbol: SH2B1
• Gene ID (NCBI): 25970
• RRID: AB_2877838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRF2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SH2B1 is a member of the SH2-domain containing mediators family. SH2B1 has been shown to interact with INS receptor, Grb2, TrkA and Janus kinase 2. Variations close to or in the SH2B1 gene have been found to associate with obesity in two large genome wide association studies of body mass index (PMID: 19079260). SH2B1deletions are associated with severe early-onset obesity (PMID: 19966786).