SH3BGRL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SH3BGRL2 Polyclonal antibody (21944-1-AP)

• Featured Product
• KD/KO Validated

SH3BGRL2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21944-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SH3 domain-binding glutamic acid-rich-like protein 2, Fovea-associated SH3 domain-binding protein, FASH3

• 

  WB analysis of mouse brain using 21944-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 21944-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 21944-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 21944-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21944-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 21944-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 21944-1-AP (SH3BGRL2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SH3BGRL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse liver tissue, human placenta tissue
• Positive IHC detected in: human liver tissue, human placenta tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21944-1-AP targets SH3BGRL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16638

  Product name: Recombinant human SH3BGRL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of BC040489

  Sequence: MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDTTMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP

• Full Name: SH3 domain binding glutamic acid-rich protein like 2
• Calculated Molecular Weight: 107 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC040489
• Gene Symbol: SH3BGRL2
• Gene ID (NCBI): 83699
• RRID: AB_11182822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJC5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SH3BGRL2 Polyclonal antibody (catalog number 21944-1-AP) has 3 total citations. These appear in Frontiers in Pharmacology, American Journal of Cancer Research, and Journal of Thoracic Disease. The associated research fields focus on cancer biology, including prostate cancer (miR-138-5p/SIRT1/SREBP1 pathway and lipid metabolism), breast cancer growth and metastasis (TGF-β1 regulation), and esophageal squamous cell carcinoma (tumor suppression and prognosis). Applications cited include Western blot and immunohistochemistry in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Pharmacol; Astragalus Polysaccharides Inhibits Tumorigenesis and Lipid Metabolism Through miR-138-5p/SIRT1/SREBP1 Pathway in Prostate Cancer.; Authors - Shanqi Guo
human	WB	Am J Cancer Res; SH3BGRL2 exerts a dual function in breast cancer growth and metastasis and is regulated by TGF-β1.; Authors - Dou-Dou Li ; KD Validated
human	WB,IHC	J Thorac Dis; SH3BGRL2 as a vital tumor suppressor and prognostic factor in human esophageal squamous cell carcinoma.; Authors - Kaiyan Chen ; KD Validated