SH3BP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SH3BP1 Polyclonal antibody (20541-1-AP)

• Featured Product
• KD/KO Validated

SH3BP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20541-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

3BP 1, SH3 domain binding protein 1, SH3 domain-binding protein 1

• 

  WB analysis using 20541-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 20541-1-AP

  WB result of SH3BP1 antibody (20541-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SH3BP1 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 20541-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 20541-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 20541-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20541-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 20541-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 20541-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20541-1-AP (SH3BP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 20541-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20541-1-AP (SH3BP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 20541-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SH3BP1 antibody (20541-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 20541-1-AP

  Immunofluorescent analysis of Hela cells, using SH3BP1 antibody 20541-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SH3BP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse lung tissue, mouse spleen tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20541-1-AP targets SH3BP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14575

  Product name: Recombinant human SH3BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC008282

  Sequence: MAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPN

• Full Name: SH3-domain binding protein 1
• Calculated Molecular Weight: 701 aa, 76 kDa
• Observed Molecular Weight: 76-80 kDa, 51 kDa
• GenBank Accession Number: BC008282
• Gene Symbol: SH3BP1
• Gene ID (NCBI): 23616
• RRID: AB_10694570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3L3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

SH3BP1 Polyclonal antibody (Cat# 20541-1-AP) has a total of 7 citations published in Nature Communications, Science Advances, Phytomedicine, Frontiers in Molecular Biosciences, Cancer Medicine, Journal of the Formosan Medical Association, and bioRxiv. Associated research fields include phagocytosis and actin cytoskeleton regulation, cell-type-resolved tissue proteomics, hepatocellular carcinoma progression, colorectal tumor therapeutic targets, drug resistance in chronic myeloid leukemia, and prognostic value in acute myeloid leukemia.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; Phosphoinositide 3-kinase enables phagocytosis of large particles by terminating actin assembly through Rac/Cdc42 GTPase-activating proteins.; Authors - Daniel Schlam
		Sci Adv; NicheProt: Cell-type-resolved proteomics of tissue compartments.; Authors - Yi-Chien Wu
human, mouse	WB,IHC,IF	Phytomedicine; Seco-neokadsuranic acid A antagonizes SH3BP1 to suppress hepatocellular carcinoma progression through PPAR pathway activation.; Authors - Beixi Jia
human	WB,IHC	Front Mol Biosci; Exploring potential therapeutic targets for colorectal tumors based on whole genome sequencing of colorectal tumors and paracancerous tissues; Authors - Yufan Sheng
human	WB	Cancer Med; Reciprocal interactions among Cobll1, PACSIN2, and SH3BP1 regulate drug resistance in chronic myeloid leukemia.; Authors - Kibeom Park ; KD Validated
human	WB	J Formos Med Assoc; Prognostic impact of ARHGAP43(SH3BP1) in acute myeloid leukemia; Authors - Li Yang