SH3BP1 Polyclonal antibody

• 

  WB analysis using 20541-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 20541-1-AP

  WB result of SH3BP1 antibody (20541-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SH3BP1 transfected HepG2 cells.

• 

  WB analysis of mouse lung using 20541-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 20541-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20541-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 20541-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20541-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20541-1-AP (SH3BP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 20541-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20541-1-AP (SH3BP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 20541-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20541-1-AP (SH3BP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 20541-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SH3BP1 antibody (20541-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 20541-1-AP

  Immunofluorescent analysis of Hela cells, using SH3BP1 antibody 20541-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

SH3BP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20541-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

3BP 1, SH3 domain binding protein 1, SH3 domain-binding protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse lung tissue, mouse spleen tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

20541-1-AP targets SH3BP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14575

  Product name: Recombinant human SH3BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC008282

  Sequence: MAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHSHTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMMLLSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPN

• Full Name: SH3-domain binding protein 1
• Calculated Molecular Weight: 701 aa, 76 kDa
• Observed Molecular Weight: 76-80 kDa, 51 kDa
• GenBank Accession Number: BC008282
• Gene Symbol: SH3BP1
• Gene ID (NCBI): 23616
• RRID: AB_10694570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3L3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; Phosphoinositide 3-kinase enables phagocytosis of large particles by terminating actin assembly through Rac/Cdc42 GTPase-activating proteins.; Authors - Daniel Schlam
human	WB	Cancer Med; Reciprocal interactions among Cobll1, PACSIN2, and SH3BP1 regulate drug resistance in chronic myeloid leukemia.; Authors - Kibeom Park ; KD Validated
human	WB	J Formos Med Assoc; Prognostic impact of ARHGAP43(SH3BP1) in acute myeloid leukemia; Authors - Li Yang