SH3BP5L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SH3BP5L Polyclonal antibody, PBS Only (27446-1-PBS)

• 

  WB analysis using 27446-1-AP (same clone as 27446-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27446-1-AP (SH3BP5L antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27446-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27446-1-AP (same clone as 27446-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27446-1-AP (SH3BP5L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27446-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27446-1-AP (same clone as 27446-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27446-1-AP (SH3BP5L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27446-1-PBS in a different storage buffer formulation.

SH3BP5L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27446-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

KIAA1720, SH3BP 5 like

---

Product Information

27446-1-PBS targets SH3BP5L in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23990

  Product name: Recombinant human SH3BP5L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-393 aa of BC017254

  Sequence: QFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPEDMEDGDSGIEGAEGAGLEEGSSLGPGPAPDTDTLSLLSLRTVASDLQKCDSVEHLRGLSDHVSLDGQELGTRSGGRRGSDGGARGGRHQRSVSL

• Full Name: SH3-binding domain protein 5-like
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC017254
• Gene Symbol: SH3BP5L
• Gene ID (NCBI): 80851
• RRID: AB_3742231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8J4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SH3BP5L (SH3 Binding Domain Protein 5 Like) is a protein-coding gene that encodes a protein with a conserved N-terminus and functions as a guanine nucleotide exchange factor (GEF) for Rab11 GTPases.