SHISA8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SHISA8 Polyclonal antibody, PBS Only (30240-1-PBS)

• 

  IHC staining of human lung using 30240-1-AP (same clone as 30240-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 30240-1-AP (SHISA8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30240-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 30240-1-AP (same clone as 30240-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 30240-1-AP (SHISA8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30240-1-PBS in a different storage buffer formulation.

SHISA8 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30240-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

30240-1-PBS targets SHISA8 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31420

  Product name: Recombinant human SHISA8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-300 aa of NM_001353438

  Sequence: RLGLERAHSPRARRTVTRALTELLKQPGPQEPLPPTLGPPLGGCVQVQMGDGLPRGSPHNSADKKRLNNAPRGSAAPGPPRGPRLQGGGSLTLQPDYAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSP

• Full Name: transmembrane protein 46-like
• Calculated Molecular Weight: 42KD
• GenBank Accession Number: NM_001353438
• Gene Symbol: SHISA8
• Gene ID (NCBI): 440829
• RRID: AB_3086274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: B8ZZ34
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The least studied AMPAR-interacting member of the Shisa protein family is SHISA8 (CKAMP39). In HEK293 cells, SHISA8 significantly affected AMPAR-mediated current kinetics, such as current amplitude, as well as AMPAR desensitization and recovery from desensitization (PMID:33892364).