SHPK Recombinant monoclonal antibody

• 

  IHC staining of Human Hepatocellular cancer using 82875-1-RR

  Immunohistochemical analysis of paraffin-embedded Human Hepatocellular cancer slide using 82875-1-RR (SHPK antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of Human Hepatocellular cancer using 82875-1-RR

  Immunohistochemical analysis of paraffin-embedded Human Hepatocellular cancer slide using 82875-1-RR (SHPK antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 82875-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using SHPK antibody (82875-1-RR, Clone: 230115A4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of U-2 OS using 82875-1-RR

  1x10^6 U-2 OS were intracellularly stained with 0.25 ug Anti-Human SHPK (82875-1-RR, Clone:230115A4) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:166(red), or 0.25 ug rabbit IgG isotype control. Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• 

  Affinity and Kinetic Characterization of 82875-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82875-1-RR against Human SHPK were performed. The affinity constant is 18.1 pM.

SHPK Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), ELISA

Cat No. 82875-1-RR

Clone No.230115A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), ELISA

Synonyms

230115A4, Carbohydrate kinase-like protein, CARKL, EC:2.7.1.14, Sedoheptulokinase

---

Tested Applications

• Positive IHC detected in: Human Hepatocellular cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: U-2 OS

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82875-1-RR targets SHPK in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33893

  Product name: Recombinant human SHPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-253 aa of BC020543

  Sequence: ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQV

• Full Name: sedoheptulokinase
• Calculated Molecular Weight: 478 aa, 52 kDa
• GenBank Accession Number: BC020543
• Gene Symbol: SHPK
• Gene ID (NCBI): 23729
• RRID: AB_3670594
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHJ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SHPK, also named CARKL, is a carbohydrate kinase involved in the phosphorylation of sugars as they enter a cell, inhibiting return across the cell membrane (PubMed: 10673275). SHPK is a sedoheptulose kinase of the pentose phosphate pathway. It acts as a modulator of macrophage activation through control of glucose metabolism (PMID: 22682222).