CoraLite® Plus 488-conjugated SHPK Recombinant monoclonal antibody

SHPK Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82875
Clone No.230115A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

230115A4, Carbohydrate kinase-like protein, CARKL, EC:2.7.1.14, Sedoheptulokinase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82875 targets SHPK in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33893

Product name: Recombinant human SHPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 65-253 aa of BC020543

Sequence: ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQV

Predict reactive species
Full Name sedoheptulokinase
Calculated Molecular Weight 478 aa, 52 kDa
GenBank Accession NumberBC020543
Gene Symbol SHPK
Gene ID (NCBI) 23729
RRIDAB_3673091
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UHJ6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SHPK, also named CARKL, is a carbohydrate kinase involved in the phosphorylation of sugars as they enter a cell, inhibiting return across the cell membrane (PubMed: 10673275). SHPK is a sedoheptulose kinase of the pentose phosphate pathway. It acts as a modulator of macrophage activation through control of glucose metabolism (PMID: 22682222).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SHPK antibody CL488-82875Download protocol
IF protocol for CL Plus 488 SHPK antibody CL488-82875Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...