CoraLite® Plus 488-conjugated SHPK Recombinant monoclonal antibody

• 

  IF Staining of U2OS using CL488-82875

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using CoraLite® Plus 488 SHPK antibody (CL488-82875, Clone: 230115A4 ) at dilution of 1:200.

• 

  FC experiment of U2OS using CL488-82875

  1x10^6 U2OS cells were intracellularly stained with 0.8 ug Coralite® Plus 488 SHPK Recombinant Antibody (CL488-82875, Clone:230115A4)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

SHPK Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-82875

Clone No.230115A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

230115A4, Carbohydrate kinase-like protein, CARKL, EC:2.7.1.14, Sedoheptulokinase

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82875 targets SHPK in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33893

  Product name: Recombinant human SHPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-253 aa of BC020543

  Sequence: ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQV

• Full Name: sedoheptulokinase
• Calculated Molecular Weight: 478 aa, 52 kDa
• GenBank Accession Number: BC020543
• Gene Symbol: SHPK
• Gene ID (NCBI): 23729
• RRID: AB_3673091
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHJ6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SHPK, also named CARKL, is a carbohydrate kinase involved in the phosphorylation of sugars as they enter a cell, inhibiting return across the cell membrane (PubMed: 10673275). SHPK is a sedoheptulose kinase of the pentose phosphate pathway. It acts as a modulator of macrophage activation through control of glucose metabolism (PMID: 22682222).