SHQ1 Polyclonal antibody

• 

  WB analysis using 27020-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27020-1-AP (SHQ1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 27020-1-AP

  IP result of anti-SHQ1 (IP:27020-1-AP, 4ug; Detection:27020-1-AP 1:1500) with K-562 cells lysate 2400 ug.

• 

  IHC staining of human colon cancer using 27020-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27020-1-AP (SHQ1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 27020-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27020-1-AP (SHQ1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate hyperplasia using 27020-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 27020-1-AP (SHQ1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human prostate hyperplasia using 27020-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 27020-1-AP (SHQ1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of A431 using 27020-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using 27020-1-AP (SHQ1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Rabbit IgG(H+L).

SHQ1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 27020-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Protein SHQ1 homolog, SHQ1, SHQ1 homolog (S. cerevisiae)

---

Tested Applications

• Positive WB detected in: K-562 cells, A549 cells, HEK-293T cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human colon cancer tissue, human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

27020-1-AP targets SHQ1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25559

  Product name: Recombinant human SHQ1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-214 aa of BC017274

  Sequence: MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIGASEIPEEVVDDEEFDWEIEQTPCEEVSESALNPQCHYGFGNLRSGVLQRLQDELSDVIDIKDPDFTPAAERRQKRLAAELAKFDPDHYLADFFEDEAIEQILK

• Full Name: SHQ1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 593 aa, 67 kDa
• Observed Molecular Weight: 70 kDa~80 kDa
• GenBank Accession Number: BC017274
• Gene Symbol: SHQ1
• Gene ID (NCBI): 55164
• RRID: AB_2880725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PI26
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Nucleic Acids Res; Proteomic analyses reveal new features of the box H/ACA RNP biogenesis; Authors - Florence Schlotter
human	WB,IP,CoIP	Hum Mol Genet; The C-terminal extension of dyskerin is a dyskeratosis congenita mutational hotspot that modulates interaction with telomerase RNA and subcellular localization; Authors - Jian Qin
human,mouse	WB	Exp Neurol; Pathogenic SHQ1 variants result in disruptions to neuronal development and the dopaminergic pathway; Authors - Chien-Hui Chang ; KD Validated