SHROOM4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SHROOM4 Polyclonal antibody, PBS Only (31712-1-PBS)

• 

  IHC staining of mouse testis using 31712-1-AP (same clone as 31712-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31712-1-AP (SHROOM4 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31712-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 31712-1-AP (same clone as 31712-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31712-1-AP (SHROOM4 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31712-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31712-1-AP (same clone as 31712-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31712-1-AP (SHROOM4 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31712-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 31712-1-AP (same clone as 31712-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using SHROOM4 antibody (31712-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31712-1-PBS in a different storage buffer formulation.

SHROOM4 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 31712-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA1202, Protein Shroom4, shroom family member 4

---

Product Information

31712-1-PBS targets SHROOM4 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36423

  Product name: Recombinant human SHROOM4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1170-1320 aa of BC151240

  Sequence: GSCALNPEEVLEQPQPLSFGHLEGSRQGSQSVPAEQESFALHSSDFLPPIRGHLGSQPEQAQPPCYYGIGGLWRTSGQEATESAKQEFQHFSPPSGAPGIPTSYSAYYNISVAKAELLNKLKDQPEMAEIGLGEEEVDHELAQKKIQLIES

• Full Name: shroom family member 4
• GenBank Accession Number: BC151240
• Gene Symbol: SHROOM4
• Gene ID (NCBI): 57477
• RRID: AB_3742464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9ULL8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Shroom-related gene SHROOM4 (formerly called KIAA1202) has also been implicated in neural development, as mutations in this gene are associated with human X-linked mental retardation. SHROOM4 is expressed in a wide range of tissue types during mouse development, including the vascular endothelium of the lung and the polarized epithelium of the neural tube and kidney.