SIAE Monoclonal antibody

• 

  WB analysis using 66522-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66522-1-Ig (SIAE antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig colon using 66522-1-Ig

  pig colon tissue were subjected to SDS PAGE followed by western blot with 66522-1-Ig (SIAE antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 66522-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66522-1-Ig (SIAE antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 66522-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using SIAE antibody (66522-1-Ig, Clone: 1G5F7 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red).

SIAE Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66522-1-Ig

Clone No.1G5F7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, ELISA

Synonyms

Sialate O-acetylesterase, LSE, H-Lse, H Lse, EC:3.1.1.53

---

Tested Applications

• Positive WB detected in: pig liver tissue, pig colon tissue, rat colon tissue, mouse liver tissue
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2500-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66522-1-Ig targets SIAE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14624

  Product name: Recombinant human SIAE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC068450

  Sequence: MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV

• Full Name: sialic acid acetylesterase
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC068450
• Gene Symbol: SIAE
• Gene ID (NCBI): 54414
• RRID: AB_2881885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9HAT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.