CoraLite® Plus 488-conjugated SIAE Monoclonal antibody

• 

  IF Staining of PC-3 using CL488-66522

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using CoraLite® Plus 488 SIAE antibody (CL488-66522, Clone: 1G5F7 ) at dilution of 1:600, CL594-Phalloidin (red).

• 

  FC experiment of PC-3 using CL488-66522

  1X10^6 PC-3 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human SIAE (CL488-66522, Clone:1G5F7) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

SIAE Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66522

Clone No.1G5F7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

Synonyms

Sialate O-acetylesterase, LSE, H-Lse, H Lse, EC:3.1.1.53

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells
• Positive FC (Intra) detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66522 targets SIAE in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14624

  Product name: Recombinant human SIAE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC068450

  Sequence: MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV

• Full Name: sialic acid acetylesterase
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC068450
• Gene Symbol: SIAE
• Gene ID (NCBI): 54414
• RRID: AB_3084254
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9HAT2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.