Use Able AI chat for product recommendations

SIGMAR1 Recombinant monoclonal antibody, PBS Only (Detector)

SIGMAR1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 85064-1-PBS
Clone No.242621C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

242621C6, AAG8, Aging-associated gene 8 protein, hSigmaR1, OPRS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85064-1-PBS targets SIGMAR1 as part of a matched antibody pair:

MP01809-1: 85064-2-PBS capture and 85064-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7351

Product name: Recombinant human SIGMAR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 101-223 aa of BC004899

Sequence: SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Predict reactive species
Full Name sigma non-opioid intracellular receptor 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC004899
Gene Symbol SIGMAR1
Gene ID (NCBI) 10280
RRIDAB_3743982
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99720
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SIGMAR1, also named as OPRS1, SRBP, SIG-1R and AAG8, belongs to the ERG2 family. It is an endoplasmic reticulum chaperone that binds a wide variety of ligands, including neurosteroids, psychostimulants, and dextrobenzomorphans. SIGMAR1 is ubiquitously expressed, and is enriched in motor neurons of the brain and spinal cord. It plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. SIGMAR1 plays a role in several other cell functions including proliferation, survival and death. SDS-PAGE and Western blot analysis showed that SIGMAR1 has an apparent molecular mass of 25 kDa. SIGMAR1 has 5 isoforms with MW 21-27kDa and 12kDa.

Loading...
||
New chat

Able

正在加载,请稍候...