Use Able AI chat for product recommendations

SIGMAR1 Recombinant monoclonal antibody

SIGMAR1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85064-1-RR
Clone No.242621C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

242621C6, AAG8, Aging-associated gene 8 protein, hSigmaR1, OPRS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, COLO 320 cells, C2C12 cells, C6 cells, mouse colon tissue, ratcolon tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85064-1-RR targets SIGMAR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7351

Product name: Recombinant human SIGMAR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 101-223 aa of BC004899

Sequence: SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Predict reactive species
Full Name sigma non-opioid intracellular receptor 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC004899
Gene Symbol SIGMAR1
Gene ID (NCBI) 10280
RRIDAB_3743982
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99720
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIGMAR1, also named as OPRS1, SRBP, SIG-1R and AAG8, belongs to the ERG2 family. It is an endoplasmic reticulum chaperone that binds a wide variety of ligands, including neurosteroids, psychostimulants, and dextrobenzomorphans. SIGMAR1 is ubiquitously expressed, and is enriched in motor neurons of the brain and spinal cord. It plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. SIGMAR1 plays a role in several other cell functions including proliferation, survival and death. SDS-PAGE and Western blot analysis showed that SIGMAR1 has an apparent molecular mass of 25 kDa. SIGMAR1 has 5 isoforms with MW 21-27kDa and 12kDa.

Protocols

Product Specific Protocols
IF protocol for SIGMAR1 antibody 85064-1-RRDownload protocol
IHC protocol for SIGMAR1 antibody 85064-1-RRDownload protocol
WB protocol for SIGMAR1 antibody 85064-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...