Mouse SIGNR1/CD209b Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse spleen using 84365-5-RR (same clone as 84365-5-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 84365-5-RR (SIGNR1/CD209b antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84365-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84365-5-RR (same clone as 84365-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84365-5-RR (SIGNR1/CD209b antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84365-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84365-5-RR (same clone as 84365-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84365-5-RR (SIGNR1/CD209b antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84365-5-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 84365-5-RR (same clone as 84365-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using SIGNR1/CD209b antibody (84365-5-RR, Clone: 241726B1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84365-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84365-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84365-5-RR against Mouse SIGNR1/CD209b were performed. The affinity constant is 0.155 nM.

SIGNR1/CD209b Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84365-5-PBS

Clone No.241726B1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

241726B1, CD209, CD209 antigen-like protein B, Cd209b, DC-SIGNR1

---

Product Information

84365-5-PBS targets SIGNR1/CD209b in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1497

  Product name: Recombinant Mouse SIGNR1/CD209b protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 74-325 aa of NM_026972.5

  Sequence: QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG

• Full Name: CD209b antigen
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: NM_026972.5
• Gene Symbol: Cd209b
• Gene ID (NCBI): 69165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8CJ91-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SIGNR1 (CD209b) is a mouse homolog of the human DC-SIGN receptor (PMID: 11581173). SIGNR1 is a type II transmembrane protein with an extracellular domain consisting of a neck region made up of four repeats of 28 amino acids and a carbohydrate recognition domain (PMID: 15583012). It is expressed on marginal zone macrophages and peritoneal macrophages and is a key receptor for the recognition and efficient clearance of pathogens by the innate immune system.