SIN1/MAPKAP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85702-4-RR (same clone as 85702-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85702-4-RR (MAPKAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85702-4-PBS in a different storage buffer formulation.

SIN1/MAPKAP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85702-4-PBS

Clone No.242861G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MAPKAP1, MIP1, Mitogen-activated protein kinase 2-associated protein 1, SAPK interacting protein 1, SIN1

---

Product Information

85702-4-PBS targets SIN1/MAPKAP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7753

  Product name: Recombinant human MAPKAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-324 aa of BC002326

  Sequence: MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD

• Full Name: mitogen-activated protein kinase associated protein 1
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC002326
• Gene Symbol: MAPKAP1
• Gene ID (NCBI): 79109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BPZ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitogen-activated protein kinase 2-associated protein 1 (MAPKAP1) is also named as MIP1 and SIN1. SIN1/MAPKAP1 is a major partner of mTORC2, acting as a scaffold and responsible for the substrate specificity of the mTOR catalytic subunit (PMID: 37877351). Besides as a component of MTORC2, MAPKAP1 also functions as MEKK2 and Ras-interacting protein and involves in regulating MEKK2 activation and RAS signaling (PMID: 31773361).