SIN3A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIN3A Polyclonal antibody (14638-1-AP)

• KD/KO Validated

SIN3A Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 14638-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

KIAA0700

• 

  WB analysis of Jurkat using 14638-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14638-1-AP

  WB result of SIN3A antibody (14638-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SIN3A transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14638-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14638-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 14638-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 14638-1-AP

  IP result of anti-SIN3A (IP:14638-1-AP, 4ug; Detection:14638-1-AP 1:500) with Jurkat cells lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14638-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SIN3A antibody (14638-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SIN3A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells, K-562 cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14638-1-AP targets SIN3A in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6219

  Product name: Recombinant human SIN3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-156 aa of BC066364

  Sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVVFSSFSWVKKFIFSRKYWLQLVGCGGTTSNLRY

• Full Name: SIN3 homolog A, transcription regulator (yeast)
• Calculated Molecular Weight: 145 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC066364
• Gene Symbol: SIN3A
• Gene ID (NCBI): 25942
• RRID: AB_2301741
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96ST3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

SIN3A Polyclonal antibody (Cat# 14638-1-AP) has 10 citations published in journals including Nature Communications, Bioactive Materials, Theranostics, International Journal of Biological Sciences, Cell Reports, Cell Biosciences, Journal of Inflammation Research, Human Molecular Genetics, and bioRxiv. Research fields span epigenetics, intestinal barrier biology, adiposity, urothelial carcinoma, atherosclerosis, triple-negative breast cancer, allergic rhinitis, Rett syndrome, and ER stress-mediated tissue quality control.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Bioact Mater; Chitosan/PLGA-based tissue engineered nerve grafts with SKP-SC-EVs enhance sciatic nerve regeneration in dogs through miR-30b-5p-mediated regulation of axon growth; Authors - Miaomei Yu
mouse,human	WB	Nat Commun; Phytic acid (InsP(6)) activates HDAC3 epigenetic axis to maintain intestinal barrier function.; Authors - Sujan Chatterjee
mouse	WB,IP	Nat Commun; Glucocorticoids increase adiposity by stimulating Krüppel-like factor 9 expression in macrophages; Authors - Yinliang Zhang
human	WB	Theranostics; SLC14A1 prevents oncometabolite accumulation and recruits HDAC1 to transrepress oncometabolite genes in urothelial carcinoma.; Authors - Ti-Chun Chan
human	WB,CoIP	Int J Biol Sci; TET1s deficiency exacerbates oscillatory shear flow-induced atherosclerosis.; Authors - Kai Qu
		Cell Rep; ZNF451 favors triple-negative breast cancer progression by enhancing SLUG-mediated CCL5 transcriptional expression; Authors - Yu Zhang