SIP1 Polyclonal antibody

• 

  WB analysis of HepG2 using 21672-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21672-1-AP (SIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 21672-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 21672-1-AP (SIP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21672-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21672-1-AP (SIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 21672-1-AP

  IP result of anti-SIP1 (IP:21672-1-AP, 4ug; Detection:21672-1-AP 1:500) with HepG2 cells lysate 1000ug.

SIP1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 21672-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

Component of gems 2, Gemin 2, GEMIN2, SIP1, SIP1 delta, SMN interacting protein 1

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, rat brain tissue
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

21672-1-AP targets SIP1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16500

  Product name: Recombinant human SIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-280 aa of BC104968

  Sequence: MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

• Full Name: survival of motor neuron protein interacting protein 1
• Calculated Molecular Weight: 280 aa, 32 kDa
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: BC104968
• Gene Symbol: SIP1
• Gene ID (NCBI): 8487
• RRID: AB_10859249
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14893
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; Functional interaction between FUS and SMN underlies SMA-like splicing changes in wild-type hFUS mice.; Authors - Alessia Mirra
human		Neurobiol Dis; UsnRNP trafficking is regulated by stress granules and compromised by mutant ALS proteins.; Authors - Simona Rossi
human	WB	J Mol Med (Berl); Hyper-SUMOylation of SMN induced by SENP2 deficiency decreases its stability and leads to spinal muscular atrophy-like pathology.; Authors - Yuhong Zhang
human	WB	Biomolecules; (20S)G-Rh2 Inhibits NF-κB Regulated Epithelial-Mesenchymal Transition by Targeting Annexin A2.; Authors - Yu-Shi Wang